| 產(chǎn)品詳情 |
| Edit |   |
|---|
| Antigenic Specificity | B3GNT8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband? antibody for UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8(B3GNT8) detection. Tested with WB, IHC-P in Human. No cross reactivity with other proteins. B3GNT8 is a galactosyltransferase involved in the synthesis of poly-N-acetyllactosamine (polyLacNAc), a linear chain of repeating LacNAc units made up of galactose (Gal) and N-acetylglucosamine (GlcNAc) with the structure (Gal-beta-1-4-GlcNAc-beta-1-3)n. By genomic sequence analysis, the B3GNT8 gene is mapped to chromosome 19q13.2. It was showed that a soluble form of B3GNT8 overexpressed by transfected HEK293 cells selectively transferred GlcNAc from UDP-GlcNAc to the nonreducing terminus of Gal-beta-1-4-GlcNAc-alpha-p-nitrophenyl phosphate and to lactoside-alpha-benzoyl. It did not utilize keratan sulfates or polylactosamine oligosaccharide as substrate. B3GNT8 activity required Mn(2+) and showed less efficiency with Co(2+). The pH optimum was between 7 and 7.5. B3GNT8 also transferred GlcNAc onto alpha-1-acid glycoprotein and ovomucoid, which possess tetraantennary complex type and pentaantennary complex type N-glycans. With a tetraantennary N-glycan substrate, B3GNT8 appeared to prefer the beta-1-2 branch over the beta-1-6 branch. When overexpressed in HCT15 human colon cancer cells, B3GNT8 increased cell surface expression of both polyLacNAc and beta-1-6-branched N-glycans. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human B3GNT8 (360-397aa ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC), different from the related mouse sequence by sixteen amino acids. |
|---|
| Other Names | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8;BGnT-8;Beta-1,3-Gn-T8;Beta-1,3-N-acetylglucosaminyltransferase 8;Beta3Gn-T8;2.4.1.-;B3GNT8 ;B3GALT7 , BGALT15 ; |
|---|
| Gene, Accession # | B3GNT8, UniProt: Q7Z7M8 |
|---|
| Catalog # | PB9686 |
|---|
| Price | |
|---|
| Order / More Info | B3GNT8 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 產(chǎn)品資料 |
|
|