| Edit |   |
|---|
| Antigenic Specificity | Nucleoporin 50kDa (NUP50) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. NUP50 is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. |
|---|
| Immunogen | NUP50 antibody was raised using the C terminal of NUP50 corresponding to a region with amino acids TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED |
|---|
| Other Names | wu:fa56e03|wu:fb78a08|GB18194|npap60|npap60l|Nup50|Rtp60|1700030K07Rik|AI413123|Npap60|NPAP60|NPAP60L |
|---|
| Gene, Accession # | Gene ID: 10762 |
|---|
| Catalog # | ABIN631630 |
|---|
| Price | |
|---|
| Order / More Info | Nucleoporin 50kDa (NUP50) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|