| Edit |   |
|---|
| Antigenic Specificity | Nucleoporin 98kDa (NUP98) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The nuclear pore complex (NPC) is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kDa nucleoporin is localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kDa nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL). |
|---|
| Immunogen | NUP98 antibody was raised using the N terminal of NUP98 corresponding to a region with amino acids EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF |
|---|
| Other Names | CG10198|CG10201|Dmel\\CG10198|Nup 96|Nup 98|Nup-98|Nup96|Nup98|Nup98-Nup96|Nup98/96|l(3)95BCd|nup145|nup98-96|GB12688|NUP98|4732457F17|AI849286|im:7151238|zgc:113968|zgc:63593|ADIR2|NUP196|NUP96 |
|---|
| Gene, Accession # | Gene ID: 4928,81738 |
|---|
| Catalog # | ABIN634181 |
|---|
| Price | |
|---|
| Order / More Info | Nucleoporin 98kDa (NUP98) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|