| 產(chǎn)品詳情 |
| Edit |   |
|---|
| Antigenic Specificity | Exportin-5/XPO5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband? antibody for Exportin-5(XPO5) detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. Exportin-5 (XPO5) is a protein that in humans is encoded by the XPO5 gene. The International Radiation Hybrid Mapping Consortium mapped the XPO5 gene to chromosome 6. This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Exportin-5 (2-43aa AMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEK), different from the related mouse sequence by four amino acids. |
|---|
| Other Names | Exportin-5;Exp5;Ran-binding protein 21;XPO5;KIAA1291, RANBP21; |
|---|
| Gene, Accession # | XPO5, UniProt: Q9HAV4 |
|---|
| Catalog # | A02900 |
|---|
| Price | |
|---|
| Order / More Info | Exportin-5/XPO5 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 產(chǎn)品資料 |
|
|