| Edit |   |
|---|
| Antigenic Specificity | PPP1R3F |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPP1R3F Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP1R3F. This antibody reacts with human. The PPP1R3F Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PPP1R3F antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TDGGMSPSHPLGILTDRDLILKWPGPERALNSALAEEITLHYARLGRGVELIKDTEDPDDEGEGEEGLSVTPSSPEGDSPKESPPEILSGARSVVATMGDVWLP |
|---|
| Other Names | HB2E, protein phosphatase 1 regulatory subunit 3F, protein phosphatase 1, regulatory subunit 3F, regulatory (inhibitor) subunit 3F |
|---|
| Gene, Accession # | PPP1R3F, Gene ID: 89801 |
|---|
| Catalog # | NBP2-55111 |
|---|
| Price | |
|---|
| Order / More Info | PPP1R3F Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|