| 產(chǎn)品詳情 |
| Edit |   |
|---|
| Antigenic Specificity | ZP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-ZP1 Antibody. Reactivity: Human, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ZP1 (102-139aa HVLEKDGRFHLRVFMEAVLPNGRVDVAQDATLICPKPD), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids. |
|---|
| Other Names | zona pellucida sperm-binding protein 1; Zona pellucida sperm-binding protein 1; zona pellucida sperm-binding protein 1; zona pellucida glycoprotein 1; Zona pellucida glycoprotein 1; Zp-1, ZP1; ZP1; OOMD; OOMD1; HEL163; Zp-1 |
|---|
| Gene, Accession # | ZP1, Gene ID: 22917, NCBI: NP_997224.2, UniProt: P60852 |
|---|
| Catalog # | MBS178470 |
|---|
| Price | |
|---|
| Order / More Info | ZP1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Gross, M. B. Personal Communication. Baltimore, Md. 6/24/2014. 2. Huang, Hua-Lin; Lv, Chao; Zhao, Ying-Chun; Li, Wen; He, Xue-Mei; Li, Ping; Sha, Ai-Guo; Tian, Xiao; Papasian, Christopher J.; Deng, Hong-Wen; Lu, Guang-Xiu; Xiao, Hong-Mei (2014). Mutant ZP1 in Familial Infertility. New England Journal of Medicine 370 (13): 1220-1226. 3. Rankin, T., Talbot, P., Lee, E., Dean, J. Abnormal zonae pellucidae in mice lacking ZP1 result in early embryonic loss.Development 126: 3847-3855, 1999 |
|---|
| 產(chǎn)品資料 |
|
|