| 產(chǎn)品詳情 |
| Edit |   |
|---|
| Antigenic Specificity | MLH1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband? antibody for DNA mismatch repair protein Mlh1(MLH1) detection. Tested with WB in Human. No cross reactivity with other proteins. MutL homolog 1, colon cancer, nonpolyposis type 2 (E. coli) is a protein that in humans is encoded by the MLH1 gene located on Chromosome 3. This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). It is a human homolog of the E. coli DNA mismatch repair gene mutL, consistent with the characteristic alterations in microsatellite sequences (RER+phenotype) found in HNPCC. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described, but their full-length natures have not been determined. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human MLH1 (722-756aa KALRSHILPPKHFTEDGNILQLANLPDLYKVFERC), different from the related mouse sequence by three amino acids, and from the related rat sequence by four amino acids. |
|---|
| Other Names | DNA mismatch repair protein Mlh1;MutL protein homolog 1;MLH1;COCA2; |
|---|
| Gene, Accession # | MLH1, UniProt: P40692 |
|---|
| Catalog # | PB9724 |
|---|
| Price | |
|---|
| Order / More Info | MLH1 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 產(chǎn)品資料 |
|
|