| Edit |   |
|---|
| Antigenic Specificity | PARN |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse; human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-PARN Antibody |
|---|
| Immunogen | The immunogen for anti-PARN antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IEEADFFAIDGEFSGISNGPSVTALTSGFDTPEERYQKLKKHSMDFLLFQ |
|---|
| Other Names | DAN, poly(A)-specific ribonuclease |
|---|
| Gene, Accession # | PARN, Accession: NM_028761 |
|---|
| Catalog # | TA329951 |
|---|
| Price | |
|---|
| Order / More Info | PARN Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|