| Edit |   |
|---|
| Antigenic Specificity | ZSWIM3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ZSWIM3 antibody. Specificity: ZSWIM3 antibody was raised against the N terminal of ZSWIM3 |
|---|
| Immunogen | ZSWIM3 antibody was raised using the N terminal of ZSWIM3 corresponding to a region with amino acids SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRY |
|---|
| Other Names | ZSWIM3; ZSWIM3; ZSWIM 3; ZSWIM3; C20orf164; ZSWIM-3; Zinc Finger Swim-Type Containing 3, |
|---|
| Gene, Accession # | ZSWIM3 |
|---|
| Catalog # | MBS5302454 |
|---|
| Price | |
|---|
| Order / More Info | ZSWIM3 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|