| 產(chǎn)品詳情 |
| Edit |   |
|---|
| Antigenic Specificity | Cytokeratin 19 |
|---|
| Clone | 3D4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | unconjugated |
|---|
| Size | 100ug |
|---|
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
|---|
| Applications | IF, IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Mouse IgG monoclonal Picoband? antibody for Cytokeratin 19 detection. Tested with WB, IHC-P, IF in Human. No cross reactivity with other proteins. Keratin, type I cytoskeletal 19 is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, KRT19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids. |
|---|
| Other Names | Keratin, type I cytoskeletal 19; Cytokeratin-19; CK-19; Keratin-19; K19; KRT19 |
|---|
| Gene, Accession # | KRT19, UniProt: P08727 |
|---|
| Catalog # | M02101-2 |
|---|
| Price | |
|---|
| Order / More Info | Cytokeratin 19 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 產(chǎn)品資料 |
|
|