| Edit |   |
|---|
| Antigenic Specificity | Fibrinogen Alpha |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Fibrinogen Alpha antibody. Specificity: Fibrinogen Alpha antibody was raised against the N terminal of FGA |
|---|
| Immunogen | Fibrinogen Alpha antibody was raised using the N terminal of FGA corresponding to a region with amino acids MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS |
|---|
| Other Names | Fibrinogen Alpha; Fibrinogen Alpha; Fib2; FGA, |
|---|
| Gene, Accession # | n/a |
|---|
| Catalog # | MBS5301704 |
|---|
| Price | |
|---|
| Order / More Info | Fibrinogen Alpha Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|