| Edit |   |
| Antigenic Specificity | PLOD1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 86%, rat 84%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human PLOD1 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: FVSLFFQRLLRLHYPQKHMRLFIHNHEQHHKAQVEEFLAQHGSEYQSVKLVGPEVRMANADARN |
| Other Names | procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1, LH1, LLH, PLOD |
| Gene, Accession # | Gene ID: 5351, UniProt: Q02809, ENSG00000083444 |
| Catalog # | HPA055799 |
| Price | |
| Order / More Info | PLOD1 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |