| Edit |   |
|---|
| Antigenic Specificity | SMURF 2/SMURF2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat (predicted: hamster) |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal antibody for E3 ubiquitin-protein ligase SMURF2(SMURF2) detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. E3 ubiquitin-protein ligase SMURF2 is an enzyme that in humans is encoded by the SMURF2 gene. The SMURF2 gene is mapped to chromosome 17q22-q23 based on sequence similarity between the SMURF2 sequence and a genomic contig. SMURF2 is a HECT domain E3 ubiquitin ligase involved in degradation of SMADs, TGF-beta receptor (TGFBR), and other substrates. It also functions in regulation of neuronal and planar cell polarity, induction of senescence, and tumor suppression |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human SMURF 2 (317-351aa DHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQ), identical to the related mouse sequence. |
|---|
| Other Names | E3 ubiquitin-protein ligase SMURF2;hSMURF2;6.3.2.-;SMAD ubiquitination regulatory factor 2;SMAD-specific E3 ubiquitin-protein ligase 2;SMURF2; |
|---|
| Gene, Accession # | SMURF2, UniProt: Q9HAU4 |
|---|
| Catalog # | RP1102 |
|---|
| Price | |
|---|
| Order / More Info | SMURF 2/SMURF2 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|