| Edit |   |
| Antigenic Specificity | MAP1LC3A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 97%, rat 97%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human MAP1LC3A polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: NQAFFLLVNGHSMVSVSTPISEVYESEKDEDG |
| Other Names | microtubule-associated protein 1 light chain 3 alpha, ATG8E, LC3, LC3A, MAP1ALC3, MAP1BLC3 |
| Gene, Accession # | Gene ID: 84557, UniProt: Q9H492, ENSG00000101460 |
| Catalog # | HPA052474 |
| Price | |
| Order / More Info | MAP1LC3A Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |