| Edit |   |
|---|
| Antigenic Specificity | CMPK1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 100%, rat 100%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 μl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human CMPK1 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDN |
|---|
| Other Names | cytidine monophosphate (UMP-CMP) kinase 1, cytosolic, CMPK, UMP-CMPK |
|---|
| Gene, Accession # | Gene ID: 51727, UniProt: P30085, ENSG00000162368 |
|---|
| Catalog # | HPA058604 |
|---|
| Price | |
|---|
| Order / More Info | CMPK1 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|