| Edit |   |
| Antigenic Specificity | NECAB1 |
| Clone | CL0576 |
| Host Species | Mouse |
| Reactive Species | human (antigen sequence identity: mouse 98%, rat 98%) |
| Isotype | IgG2b |
| Format | Protein A purified |
| Size | 100 μl |
| Concentration | n/a |
| Applications | IHC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Mouse anti-human NECAB1 monoclonal antibody. Binds to an epitope located within the peptide sequence SIQWPGKRSS as determined by overlapping synthetic peptides. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP |
| Other Names | N-terminal EF-hand calcium binding protein 1, EFCBP1 |
| Gene, Accession # | Gene ID: 64168, UniProt: Q8N987, ENSG00000123119 |
| Catalog # | AMAb90801 |
| Price | |
| Order / More Info | NECAB1 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |