| Edit |   |
|---|
| Antigenic Specificity | ESRRG (full length) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | unconjugated |
|---|
| Size | n/a |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Mouse anti-Human ESRRG (full length) polyclonal antibody for WB. |
|---|
| Immunogen | Full length protein corresponding to Human Estrogen Related Receptor gamma aa 1-435. Mature Estrogen Related Receptor gammaSequence: MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMN GHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSM PKRLCLVCGDIASGYHYGVA |
|---|
| Other Names | ESRRG; estrogen-related receptor gamma; ERR3; NR3B3; ERRgamma; ERR gamma-2; estrogen receptor-related protein 3; nuclear receptor subfamily 3 group B member 3; |
|---|
| Gene, Accession # | ESRRG, Gene ID: 2104, UniProt: F1D8R6 |
|---|
| Catalog # | DPABH-09358 |
|---|
| Price | |
|---|
| Order / More Info | ESRRG (full length) Antibody from CREATIVE DIAGNOSTICS |
|---|
| Product Specific References | n/a |
|---|