| 產(chǎn)品詳情 |
| Edit |   |
|---|
| Antigenic Specificity | SLUG/SNAI2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat (predicted: hamster) |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband? antibody for Zinc finger protein SNAI2(SNAI2) detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. SLUG is also known as SNAI2. This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human SLUG (116-148aa KLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQ), identical to the related mouse and rat sequences. |
|---|
| Other Names | Zinc finger protein SNAI2;Neural crest transcription factor Slug;Protein snail homolog 2;SNAI2;SLUG, SLUGH; |
|---|
| Gene, Accession # | SNAI2, UniProt: O43623 |
|---|
| Catalog # | PB9439 |
|---|
| Price | |
|---|
| Order / More Info | SLUG/SNAI2 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 產(chǎn)品資料 |
|
|