| 產(chǎn)品詳情 |
| Edit |   |
|---|
| Antigenic Specificity | Dishevelled 3/DVL3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband? antibody for Segment polarity protein dishevelled homolog DVL-3(DVL3) detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. Segment polarity protein dishevelled homolog DVL-3 is a protein that in humans is encoded by the DVL3 gene. It is mapped to 3q27.1. This gene is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397-434aa DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMW L), identical to the related mouse sequence. |
|---|
| Other Names | Segment polarity protein dishevelled homolog DVL-3;Dishevelled-3;DSH homolog 3;DVL3;KIAA0208; |
|---|
| Gene, Accession # | DVL3, UniProt: Q92997 |
|---|
| Catalog # | A03577 |
|---|
| Price | |
|---|
| Order / More Info | Dishevelled 3/DVL3 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 產(chǎn)品資料 |
|
|