| 產(chǎn)品詳情 |
| Edit |   |
|---|
| Antigenic Specificity | Dishevelled 2/DVL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband? antibody for Segment polarity protein dishevelled homolog DVL-2(DVL2) detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. Segment polarity protein dishevelled homolog DVL-2 is a protein that in humans is encoded by the DVL2 gene. This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40% amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Dishevelled 2 (35-64aa AERITLGDFKSVLQRPAGAKYFFKSMDQDF), identical to the related mouse sequence. |
|---|
| Other Names | Segment polarity protein dishevelled homolog DVL-2;Dishevelled-2;DSH homolog 2;DVL2; |
|---|
| Gene, Accession # | DVL2, UniProt: O14641 |
|---|
| Catalog # | A02404-3 |
|---|
| Price | |
|---|
| Order / More Info | Dishevelled 2/DVL2 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 產(chǎn)品資料 |
|
|