| 產(chǎn)品詳情 |
| Edit |   |
|---|
| Antigenic Specificity | HTRA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | unconjugated |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband? antibody for HTRA1 detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. Serine protease HTRA1 is an enzyme that in humans is encoded by the HTRA1 gene. This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD). |
|---|
| Other Names | Serine protease HTRA1; High-temperature requirement A serine peptidase 1; L56; Serine protease 11; HTRA1; HTRA; PRSS11 |
|---|
| Gene, Accession # | HTRA1, UniProt: Q92743 |
|---|
| Catalog # | A01801-1 |
|---|
| Price | |
|---|
| Order / More Info | HTRA1 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 產(chǎn)品資料 |
|
|