| 產(chǎn)品詳情 |
| Edit |   |
|---|
| Antigenic Specificity | C Reactive Protein/CRP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | unconjugated |
|---|
| Size | 100ug |
|---|
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband? antibody for C Reactive Protein detection. Tested with WB, IHC-P in Human;Mouse. No cross reactivity with other proteins. C Reactive Protein (CRP) is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is composed of 5 identical, 21,500-molecular weight subunits. CRP mediates activities associated with preimmune nonspecific host resistance. CRP shows the strongest association with cardiovascular events. It is detectable on the surface of about 4% of normal peripheral blood lymphocytes. Acute phase reactant CRP is produced in the liver. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human C Reactive Protein (QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA). |
|---|
| Other Names | C-reactive protein; C-reactive protein(1-205); CRP; PTX1 |
|---|
| Gene, Accession # | CRP, UniProt: P02741 |
|---|
| Catalog # | A00249-4 |
|---|
| Price | |
|---|
| Order / More Info | C Reactive Protein/CRP Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 產(chǎn)品資料 |
|
|