| 產(chǎn)品詳情 |
| Edit |   |
|---|
| Antigenic Specificity | GAL4/LGALS4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | Flow Cytometry, IF, ICC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband? antibody for Galectin-4(LGALS4) detection. Tested with WB, ICC/IF, FCM in Human. No cross reactivity with other proteins. Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323-amino acid LGALS4 protein contains 2 homologous, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human GAL4 (283-320aa DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY), different from the related mouse and rat sequences by seven amino acids. |
|---|
| Other Names | Galectin-4;Gal-4;Antigen NY-CO-27;L-36 lactose-binding protein;L36LBP;Lactose-binding lectin 4;LGALS4; |
|---|
| Gene, Accession # | LGALS4, UniProt: P56470 |
|---|
| Catalog # | PB9952 |
|---|
| Price | |
|---|
| Order / More Info | GAL4/LGALS4 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 產(chǎn)品資料 |
|
|