| 產(chǎn)品詳情 |
| Edit |   |
|---|
| Antigenic Specificity | CPT1B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband? antibody for Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1B) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat. No cross reactivity with other proteins. CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids. |
|---|
| Other Names | Carnitine O-palmitoyltransferase 1, muscle isoform;CPT1-M;2.3.1.21;Carnitine O-palmitoyltransferase I, muscle isoform;CPT I;CPTI-M;Carnitine palmitoyltransferase 1B;Carnitine palmitoyltransferase I-like protein;CPT1B;KIAA1670; |
|---|
| Gene, Accession # | CPT1B, UniProt: Q92523 |
|---|
| Catalog # | PB9491 |
|---|
| Price | |
|---|
| Order / More Info | CPT1B Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 產(chǎn)品資料 |
|
|