| 產(chǎn)品詳情 |
| Edit |   |
|---|
| Antigenic Specificity | CFP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | unconjugated |
|---|
| Size | 100ug |
|---|
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
|---|
| Applications | IHC, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband? antibody for CFP detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. Properdin (factor P) is a plasma protein that is active in the alternative complement pathway of the innate immune system. It is mapped to Xp11.23. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human CFP (MVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKR). |
|---|
| Other Names | Properdin; Complement factor P; CFP; PFC |
|---|
| Gene, Accession # | CFP, UniProt: P27918 |
|---|
| Catalog # | A00852-2 |
|---|
| Price | |
|---|
| Order / More Info | CFP Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 產(chǎn)品資料 |
|
|