| 產(chǎn)品詳情 |
| Edit |   |
|---|
| Antigenic Specificity | Carboxypeptidase A/CPA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | unconjugated |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband? antibody for Carboxypeptidase A detection. Tested with WB in Human;Mouse;Rat. No cross reactivity with other proteins. Carboxypeptidase A1 is an enzyme that in humans is encoded by the CPA1 gene. This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. This enzyme is produced in the pancreas and preferentially cleaves C-terminal branched-chain and aromatic amino acids from dietary proteins. This gene and several family members are present in a gene cluster on chromosome 7. Mutations in this gene may be linked to chronic pancreatitis, while elevated protein levels may be associated with pancreatic cancer. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human Carboxypeptidase A (KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLD). |
|---|
| Other Names | Carboxypeptidase A1; CPA1; CPA |
|---|
| Gene, Accession # | CPA1, UniProt: P15085 |
|---|
| Catalog # | A05985-1 |
|---|
| Price | |
|---|
| Order / More Info | Carboxypeptidase A/CPA1 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 產(chǎn)品資料 |
|
|