| 產(chǎn)品詳情 |
| Edit |   |
|---|
| Antigenic Specificity | Argonaute 4/AGO4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat (predicted: bovine, canine, monkey, rabbit) |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband? antibody for Protein argonaute-4(AGO4) detection. Tested with WB in Human;Rat. No cross reactivity with other proteins. AGO4 (Argonaute 4) is also known as EIF2C4. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4 (114-153aa KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD), identical to the related mouse sequence. |
|---|
| Other Names | Protein argonaute-4 ;Argonaute4 ;hAgo4;Argonaute RISC catalytic component 4;Eukaryotic translation initiation factor 2C 4 ;eIF-2C 4 ;eIF2C 4 ;AGO4;EIF2C4, KIAA1567; |
|---|
| Gene, Accession # | AGO4, UniProt: Q9HCK5 |
|---|
| Catalog # | PB9979 |
|---|
| Price | |
|---|
| Order / More Info | Argonaute 4/AGO4 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 產(chǎn)品資料 |
|
|