| Edit |   |
|---|
| Antigenic Specificity | Melanoma Antigen Family A, 5 (MAGEA5) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 μg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. This MAGEA gene encodes a protein that is C-terminally truncated compared to other family members, and this gene can be alternatively interpreted to be a pseudogene. The protein is represented in this Entrez Gene record in accordance with the assumed protein-coding status defined in the literature. |
|---|
| Immunogen | MAGEA5 antibody was raised using the N terminal of MAGEA5 corresponding to a region with amino acids MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTL |
|---|
| Other Names | CT1.5|MAGE5|MAGEA4|Mage-a5 |
|---|
| Gene, Accession # | Gene ID: 4104 |
|---|
| Catalog # | ABIN633132 |
|---|
| Price | |
|---|
| Order / More Info | Melanoma Antigen Family A, 5 (MAGEA5) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|